Pennsylvania State Parks Near State College

Discover 35 parks within driving distance of State College

Whipple Dam State Park

Huntingdon County, Pennsylvania, USA
12 miles away

"Home to Penn State University, State College residents and students often visit Whipple Dam State Park for outdoor recreation, swimming, and hiking in a scenic natural setting."

Whipple Dam State Park provides a peaceful retreat for outdoor enthusiasts, with opportunities for swimming, boating, fishing, picnicking, and wildlife observation. The park's facilities include a sandy beach, picnic pavilions, boat rentals, and a playground. Its proximity to State College and the Rothrock State Forest makes it a popular destination for families, students, and nature lovers.

SwimmingBoating (non-motorized)FishingPicnickingWildlife watching+5 more
View park details

Penn-Roosevelt State Park

Centre County, Pennsylvania, USA
18 miles away

"Home to Penn State University, State College residents and students often seek outdoor recreation and hiking opportunities at Penn-Roosevelt State Park, just a short drive away."

Penn-Roosevelt State Park provides a rustic outdoor experience in central Pennsylvania. The park features a small campground, a scenic picnic area, and a trout-stocked stream, all set within a remote section of Rothrock State Forest. Visitors can explore miles of nearby hiking and equestrian trails, observe wildlife, and enjoy the quiet beauty of the Seven Mountains region.

campingpicnickingfishinghikinghorseback riding+3 more
View park details

Bald Eagle State Park

149 Main Park Road, Howard, PA 16841, Centre County, Pennsylvania, USA
22 miles away

"Home to Penn State University, State College residents and students often visit Bald Eagle State Park for hiking, camping, and water activities as a nearby escape from campus life."

Located in the heart of Pennsylvania, Bald Eagle State Park provides visitors with a blend of natural beauty and outdoor adventure. The park’s centerpiece is the Foster Joseph Sayers Reservoir, ideal for boating and fishing. With modern campgrounds, picnic areas, and an environmental learning center, the park is a popular destination for families and nature lovers. Its trails and observation areas offer ample opportunities for hiking, birdwatching, and photography.

boatingfishingswimminghikingbirdwatching+8 more
View park details

Black Moshannon State Park

Philipsburg, Pennsylvania
25 miles away

"Home to Penn State University, State College residents and students often visit Black Moshannon State Park for hiking, fishing, and a peaceful retreat from campus life."

Black Moshannon is renowned for its distinctive bog ecosystem and the dark, tea-colored lake that gives the park its name. The 1,992-acre protected bog natural area showcases rare plant species and unique wildlife. The park's trail system includes two boardwalk sections through the Moss-Hanne Trail, allowing visitors to experience the bog ecosystem up close without damage. The 41.5-mile Allegheny Front Trail encircles the park, offering exceptional backpacking opportunities.

HikingCampingSwimmingBoatingFishing+3 more
View park details

Reeds Gap State Park

Milroy, Mifflin County, Pennsylvania, USA
28 miles away

"Home to Penn State University, State College residents and students often visit the park for hiking, camping, and a peaceful retreat from campus life."

Located in Mifflin County, Reeds Gap State Park is a small but picturesque park that provides visitors with opportunities for picnicking, fishing, wildlife watching, and hiking. The park is surrounded by state forest land, making it a popular spot for those seeking a quiet retreat or a base for exploring the surrounding wilderness.

PicnickingFishingWildlife watchingHikingCross-country skiing+1 more
View park details

Greenwood Furnace State Park

15795 Greenwood Road, Huntingdon, PA 16652
28 miles away

"Home to Penn State University, State College residents and students often escape to Greenwood Furnace for camping, swimming, and exploring nature away from campus life."

Greenwood Furnace State Park offers a blend of history and outdoor adventure in the heart of Pennsylvania’s Rothrock State Forest. The park preserves the site of a 19th-century ironmaking village and provides opportunities for swimming, boating, hiking, camping, and wildlife viewing. With its rich heritage and natural beauty, Greenwood Furnace is a popular destination for families, history buffs, and nature lovers.

hikingswimmingfishingboatingwildlife watching+6 more
View park details

Poe Paddy State Park

Centre County, Pennsylvania, USA
30 miles away

"As the home of Penn State University, State College residents and students often visit Poe Paddy State Park for its scenic trails, fishing, and camping opportunities just a short drive away."

Poe Paddy State Park offers a peaceful retreat for outdoor enthusiasts, featuring rustic campsites, access to the scenic Penns Creek, and proximity to extensive forest lands. The park is a favorite destination for anglers, hikers, and campers seeking solitude and natural beauty. Its location along the Mid State Trail makes it a popular stop for backpackers, while the nearby Poe Paddy Tunnel adds a unique historical feature.

CampingFishingHikingWildlife viewingKayaking+4 more
View park details

Poe Valley State Park

Centre County, Pennsylvania, USA
32 miles away

"Home to Penn State University, State College offers a large population of students and families who enjoy the park's hiking, swimming, and natural beauty as a quick getaway from campus life."

Located in Centre County, Poe Valley State Park encompasses 620 acres of forested land centered around the 25-acre Poe Lake. The park provides year-round recreational opportunities, including a modern campground, a sandy beach, picnic areas, and a boat launch. Surrounded by Bald Eagle State Forest, visitors can explore miles of trails and enjoy the natural beauty of the region. The park is a popular spot for fishing, swimming, boating (electric motors only), and wildlife observation.

campingfishingswimmingboatinghiking+4 more
View park details

R.B. Winter State Park

Union County, Pennsylvania, USA
38 miles away

"As the home of Penn State University, State College is a major population center whose residents and students visit R.B. Winter State Park for outdoor activities and a break from campus life."

Nestled within the Bald Eagle State Forest, R.B. Winter State Park provides a tranquil retreat with its clear spring-fed lake, extensive picnic areas, and miles of hiking trails. The park is known for its natural beauty, abundant wildlife, and a wide range of recreational activities. Visitors can enjoy swimming, fishing, camping, and winter sports, all set against the backdrop of Pennsylvania’s scenic Ridge and Valley region.

HikingSwimmingFishingBoating (non-motorized)Camping+6 more
View park details

Canoe Creek State Park

Blair County, Pennsylvania, USA
38 miles away

"Home to Penn State University, State College is a vibrant college town whose students and families visit Canoe Creek State Park for hiking, camping, and nature exploration."

Canoe Creek State Park offers a blend of natural beauty and recreational amenities. The park’s centerpiece, Canoe Lake, is popular for fishing, boating, and swimming. The park also features extensive picnic areas, a modern campground, and several historic limestone kilns. Its limestone caves provide important bat habitat, making it a unique destination for wildlife enthusiasts. Year-round activities include hiking, birdwatching, cross-country skiing, and educational programs.

boatingfishingswimmingpicnickingwildlife watching+7 more
View park details

Sand Bridge State Park

Union County, Pennsylvania, USA
40 miles away

"As the home of Penn State University, State College students and faculty often seek out Sand Bridge State Park for day trips, hiking, and relaxation away from campus."

Sand Bridge State Park is one of Pennsylvania’s smallest state parks, covering just 3 acres. Located along Pennsylvania Route 192, the park is primarily used for picnicking and serves as a peaceful rest stop for travelers and outdoor enthusiasts. The park features shaded picnic tables, a small stream, and is surrounded by the larger Bald Eagle State Forest, providing access to hiking and wildlife viewing opportunities nearby.

PicnickingWildlife viewingPhotographyNature observation
View park details

Prince Gallitzin State Park

Patton, Pennsylvania
40 miles away

"Home to Penn State University, State College students and residents visit the park for group camping trips, hiking, and water sports."

One of Pennsylvania's largest and most complete state parks, featuring the expansive Glendale Lake spanning 1,635 acres. Over 32 miles of trails explore diverse forest habitats. Full marina services, modern camping and cabins, swimming beach, and excellent fishing make this a destination for extended outdoor vacations. Named for a Russian prince who became a Catholic missionary in Pennsylvania.

HikingCampingSwimmingFishingBoating+6 more
View park details

Trough Creek State Park

James Creek, Pennsylvania
45 miles away

"Home to Penn State University, State College residents and students often visit Trough Creek State Park for its natural beauty, waterfalls, and outdoor activities."

A hidden gem in Huntingdon County featuring spectacular natural rock formations and waterfalls. Challenging trails through a scenic gorge reward hikers with unique geological features and beautiful creek views.

HikingCampingRock ScramblingPhotographyWildlife Viewing+1 more
View park details
McCall's Dam State Park

By Carol M. Highsmith, Public domain

McCall's Dam State Park

Clinton County, Pennsylvania
45 miles away

"Home to Penn State University, State College residents visit McCall's Dam State Park for a quiet forest picnic, cool creekside relaxation, and a peaceful alternative to busier regional parks."

McCall's Dam State Park is a tiny, forested day-use area in central Pennsylvania featuring shaded picnic sites and access to scenic White Deer Creek. It serves as a quiet roadside stop within Bald Eagle State Forest.

PicnickingFishingWildlife WatchingBirdwatchingNature Study+2 more
View park details

Ravensburg State Park

Clinton County, Pennsylvania, USA
54 miles away

"As the home of Penn State University, State College offers a large population of outdoor enthusiasts who visit Ravensburg State Park for hiking, picnicking, and exploring the region’s natural beauty."

Ravensburg State Park, established in 1933, is one of Pennsylvania’s smaller state parks, offering a serene environment ideal for day-use recreation. The park is characterized by its deep ravine, lush vegetation, and the clear waters of Rauchtown Run. Facilities include picnic areas, rustic pavilions, and a small camping area. The park is named after the ravens that once nested in the cliffs above the gorge. Its peaceful atmosphere and natural features make it a hidden gem in the Pennsylvania state park system.

picnickingfishingbirdwatchingwildlife observationnature study+1 more
View park details

Hyner View State Park

Clinton County, Pennsylvania, USA
54 miles away

"State College, home to Penn State University, is a vibrant college town with a large population and serves as a hub for outdoor enthusiasts looking to explore the nearby state parks."

Located atop a mountain in Clinton County, Hyner View State Park provides one of the most iconic vistas in Pennsylvania. The park’s 6-acre area is centered around a stone overlook built by the Civilian Conservation Corps in the 1930s. Visitors enjoy picnicking, hiking, and watching hang gliders launch from the overlook. The park is also a gateway to the larger Sproul State Forest, offering access to extensive outdoor recreation opportunities.

hang glidingpicnickingwildlife watchingphotographysightseeing+1 more
View park details

S.B. Elliott State Park

Clearfield County, Pennsylvania, USA
54 miles away

"Home to Penn State University, State College is a vibrant college town whose students and families visit the park for camping, hiking, and group outings."

Nestled in the heart of Pennsylvania’s wilds, S.B. Elliott State Park spans over 300 acres of mature forests and rolling hills. The park is named after Simon B. Elliott, a prominent conservationist, and features several structures built by the CCC in the 1930s. Visitors can enjoy rustic camping, scenic picnic areas, and easy access to hiking and wildlife viewing. Its proximity to Interstate 80 makes it a convenient stop for travelers seeking a tranquil outdoor experience.

campingpicnickinghikingwildlife watchingbirding+3 more
View park details

Warriors Path State Park

Bedford County, Pennsylvania, USA
54 miles away

"As the home of Penn State University, State College is a bustling college town whose students and residents seek out Warriors Path State Park for hiking, nature study, and group outings."

Nestled in the rolling hills of Bedford County, Warriors Path State Park is a popular destination for outdoor enthusiasts. The park features a boat launch, picnic areas, and a network of hiking trails. Its tranquil river setting provides excellent opportunities for fishing and wildlife watching. The park is open year-round and is a favorite spot for family gatherings and nature lovers.

boatingfishinghikingbirdwatchingpicnicking+3 more
View park details

Milton State Park

Milton, Pennsylvania
55 miles away

"State College visitors looking for a quieter river setting beyond the mountains may travel to Milton State Park for day-use recreation and to explore small river towns along the Susquehanna."

Milton State Park is a small island park in the Susquehanna River featuring picnic areas, river access, and natural woodlands for low-impact recreation. It serves as a convenient green space for nearby communities in central Pennsylvania.

FishingBoatingKayakingCanoeingWildlife Watching+7 more
View park details

Parker Dam State Park

Penfield, Pennsylvania
55 miles away

"State College residents and Penn State students use Parker Dam State Park as a quieter alternative to busier parks, with opportunities for camping, hiking, and winter sports within a reasonable drive."

Parker Dam State Park features a 20-acre lake, historic Civilian Conservation Corps architecture, and easy access to the surrounding Moshannon State Forest. It is a popular destination for camping, fishing, hiking, and winter sports in north-central Pennsylvania.

HikingSwimmingFishingBoatingKayaking+12 more
View park details

Blue Knob State Park

Imler, Pennsylvania
55 miles away

"Home to Penn State University, State College students and residents visit Blue Knob for a change of scenery and access to year-round outdoor adventure."

Blue Knob State Park combines wilderness adventure with developed ski facilities at Pennsylvania's highest elevation ski resort. The mountain's 3,146-foot summit provides exceptional views and cool summer temperatures. The extensive trail network accommodates multiple uses while challenging terrain rewards experienced outdoor enthusiasts. The park's elevation and location in the Allegheny Mountains create distinctive mountain ecosystems.

HikingCampingDownhill SkiingCross-Country SkiingMountain Biking+2 more
View park details

Little Pine State Park

Lycoming County, Pennsylvania, USA
57 miles away

"Home to Penn State University, State College residents and students often visit the park for outdoor adventures, camping, and a change of scenery from campus life."

Little Pine State Park encompasses over 2,000 acres of forested land in north-central Pennsylvania. The park is known for its picturesque lake, abundant recreational opportunities, and peaceful atmosphere. It serves as a gateway to the Pine Creek Gorge and offers year-round activities including swimming, ice fishing, and cross-country skiing.

campingfishingboatingswimminghiking+5 more
View park details

Fowlers Hollow State Park

Perry County, Pennsylvania, USA
57 miles away

"Home to Penn State University, State College is a major college town whose students and outdoor enthusiasts visit Fowlers Hollow for hiking and camping in a less crowded setting."

Located in the heart of Perry County, Fowlers Hollow State Park provides a serene setting for outdoor enthusiasts. The park features rustic campsites, a picturesque picnic area along Fowler Hollow Run, and serves as a gateway to the extensive trail network of Tuscarora State Forest. Its small size and remote location make it ideal for those seeking solitude and a close connection with nature.

CampingPicnickingHikingFishingWildlife watching+2 more
View park details

Hyner Run State Park

North Bend, Pennsylvania
58 miles away

"State College, home to Penn State University, is a major population center in central Pennsylvania and a common origin for outdoor enthusiasts seeking the hiking and camping opportunities at Hyner Run State Park."

Hyner Run State Park serves as a gateway to backcountry adventure in the Pennsylvania Wilds region. While the park itself is small, it provides excellent camping facilities and connections to vast trail networks in surrounding state forests. The nearby Hyner View overlook offers spectacular scenery and is one of the premier hang gliding sites on the East Coast, making this area a destination for both ground-based and aerial outdoor enthusiasts.

CampingHikingBackpackingSwimmingWildlife Viewing+1 more
View park details

Little Buffalo State Park

Newport, Pennsylvania
58 miles away

"State College, home to Penn State University, sees students and families visiting the park for hiking, fishing, and a change of scenery from campus life."

Little Buffalo State Park preserves an important piece of Pennsylvania's agricultural and industrial heritage while providing quality outdoor recreation. The restored Shoaff's Mill operates during the summer season, grinding grain just as it did for over a century. The park's trails explore varied habitats from lakeside paths to ridge-top forests, while Holman Lake offers tranquil fishing and winter ice sports.

HikingFishingBoatingCampingIce Skating+2 more
View park details

Big Spring State Park

Perry County, Pennsylvania, USA
58 miles away

"Home to Penn State University, State College is a popular college town where students and faculty enjoy weekend trips to Big Spring State Park for hiking and relaxation."

Big Spring State Park covers 45 acres in Perry County and is managed by the Pennsylvania Department of Conservation and Natural Resources. The park is a popular spot for picnicking, wildlife watching, and exploring the remnants of the Newport and Shermans Valley Railroad. Its rustic stone picnic pavilion, built by the Civilian Conservation Corps in the 1930s, is a highlight for visitors. The park is surrounded by the vast Tuscarora State Forest, offering access to additional outdoor recreation opportunities.

PicnickingWildlife watchingPhotographyHistoric site explorationNature study
View park details

Susquehanna State Park

Williamsport, Lycoming County, Pennsylvania, USA
58 miles away

"Home to Penn State University, State College residents and students often visit Susquehanna State Park for a change of scenery, river activities, and group outings."

Susquehanna State Park encompasses 20 acres along the West Branch Susquehanna River in Williamsport, Pennsylvania. The park is renowned for its riverboat, the Hiawatha Paddlewheel, which offers interpretive cruises. Visitors can enjoy fishing, boating, picnicking, and birdwatching in a peaceful natural environment. The park is open year-round and provides easy access to the river and nearby attractions in Williamsport.

boatingfishingpicnickingbirdwatchingriverboat tours+1 more
View park details

Upper Pine Bottom State Park

Cummings Township, Lycoming County, Pennsylvania, USA
58 miles away

"Home to Penn State University, State College is a major population center where outdoor enthusiasts frequently travel north to enjoy the hiking, fishing, and scenic beauty of Upper Pine Bottom State Park."

Located in Lycoming County, Upper Pine Bottom State Park is one of Pennsylvania's smallest state parks, encompassing just 5 acres. It is situated at the confluence of Upper Pine Bottom Run and Little Pine Creek, offering a picturesque setting for outdoor enthusiasts. The park is unstaffed and primarily used for day-use activities, serving as a rest area for visitors to the surrounding Tiadaghton State Forest and Pine Creek Gorge.

PicnickingFishingWildlife viewingPhotographyNature observation
View park details

Cowans Gap State Park

Fort Loudon, Pennsylvania
58 miles away

"State College, home to Penn State University, offers students and residents a convenient escape to Cowans Gap for hiking, camping, and group outings."

Cowans Gap State Park combines a tranquil mountain lake setting with access to challenging backcountry trails. The park's CCC-era structures add historical character, while the connection to the Tuscarora Trail provides opportunities for both day hikes and extended backpacking adventures through the mountains. The 42-acre lake offers fishing and non-powered boating in a peaceful mountain valley.

HikingBackpackingFishingBoatingSwimming+3 more
View park details

Kings Gap Environmental Education Center

Cumberland County, Pennsylvania, USA
59 miles away

"State College, home to Penn State University, is within reach for students and residents seeking a day trip to Kings Gap for hiking and environmental education."

Kings Gap Environmental Education Center offers year-round opportunities for outdoor recreation and learning. The park is dedicated to environmental education for people of all ages and features a wide range of programs, workshops, and events. Visitors can explore extensive hiking trails, enjoy birdwatching, picnic in scenic areas, or tour the Cameron-Masland Mansion. The park's diverse habitats, including woodlands, meadows, and wetlands, provide excellent opportunities for nature study and wildlife observation.

HikingBirdwatchingNature studyEnvironmental education programsPicnicking+5 more
View park details

Bucktail State Park Natural Area

Cameron and Clinton Counties, Pennsylvania, USA
59 miles away

"State College, home to Penn State University, is a vibrant college town whose students and outdoor enthusiasts visit Bucktail State Park for hiking, photography, and wildlife watching."

Established in 1933, Bucktail State Park Natural Area encompasses over 16 miles of pristine forests and waterways in Cameron and Clinton counties. The park is a designated natural area, preserving the wild character of the Sinnemahoning Creek valley. It offers visitors a chance to experience Pennsylvania's unspoiled wilderness, observe native wildlife, and enjoy the tranquility of the region.

wildlife viewingscenic drivingphotographybird watchingfishing+1 more
View park details

Colonel Denning State Park

Newville, Pennsylvania
60 miles away

"State College, home to Penn State University, offers students and residents a scenic getaway at Colonel Denning State Park for hiking, camping, and group outings."

A small but scenic mountain park in the narrow Doubling Gap valley. The park serves as a major access point for the Tuscarora Trail long-distance hiking route. The steep climb to Flat Rock rewards hikers with outstanding views of the Cumberland Valley. Despite its small size, the park offers 18 miles of trails and a refreshing mountain lake.

HikingCampingFishingPicnickingWildlife Watching+1 more
View park details

Kettle Creek State Park

Clinton County, Pennsylvania, USA
60 miles away

"State College, home to Penn State University, offers students and locals a chance to escape to the natural beauty and tranquility of Kettle Creek State Park for outdoor adventure and relaxation."

Located in the heart of the Pennsylvania Wilds, Kettle Creek State Park spans over 1,793 acres and is surrounded by the vast Sproul State Forest. The park’s centerpiece is the Kettle Creek Reservoir, which provides ample opportunities for water-based recreation. With modern and rustic camping options, scenic picnic areas, and miles of hiking trails, the park is a haven for nature lovers and outdoor enthusiasts. The remote setting makes it ideal for those seeking peace and solitude.

fishingboatingcanoeingkayakingcamping+7 more
View park details

Shikellamy State Park

Sunbury, Pennsylvania
60 miles away

"Home to Penn State University, State College is a major college town where students and families often travel to Shikellamy State Park for hiking, sightseeing, and picnics."

Two-section park offering both river recreation and spectacular views. The famous overlook sits 360 feet above the confluence of the Susquehanna's two branches, providing panoramic vistas of the river valley. The marina section offers boating and fishing access. Named for the Oneida diplomat who helped maintain peace in colonial Pennsylvania.

PicnickingBoatingFishingHikingScenic Views+2 more
View park details

Boyd Big Tree Preserve Conservation Area

Dauphin County, Pennsylvania, USA
60 miles away

"Home to Penn State University, State College is a vibrant college town whose students and faculty may visit the park for outdoor recreation and field studies."

Boyd Big Tree Preserve Conservation Area was established to protect one of the largest contiguous forests in the region. The area is managed for conservation and passive recreation, with a focus on preserving native flora and fauna. The preserve offers over 12 miles of hiking trails, picnic areas, and interpretive programs. Its proximity to Harrisburg makes it a popular destination for nature enthusiasts seeking a quiet retreat.

HikingBirdwatchingNature studyPhotographyWildlife observation+1 more
View park details