Pennsylvania State Parks Near Lock Haven

Discover 26 parks within driving distance of Lock Haven

Bald Eagle State Park

149 Main Park Road, Howard, PA 16841, Centre County, Pennsylvania, USA
15 miles away

"A nearby college town and county seat, Lock Haven residents enjoy quick access to Bald Eagle State Park for outdoor recreation, fishing, and family outings."

Located in the heart of Pennsylvania, Bald Eagle State Park provides visitors with a blend of natural beauty and outdoor adventure. The park’s centerpiece is the Foster Joseph Sayers Reservoir, ideal for boating and fishing. With modern campgrounds, picnic areas, and an environmental learning center, the park is a popular destination for families and nature lovers. Its trails and observation areas offer ample opportunities for hiking, birdwatching, and photography.

boatingfishingswimminghikingbirdwatching+8 more
View park details

Hyner View State Park

Clinton County, Pennsylvania, USA
16 miles away

"Lock Haven, home to Lock Haven University, offers amenities and lodging for travelers and is a popular starting point for exploring the natural beauty of Clinton County."

Located atop a mountain in Clinton County, Hyner View State Park provides one of the most iconic vistas in Pennsylvania. The park’s 6-acre area is centered around a stone overlook built by the Civilian Conservation Corps in the 1930s. Visitors enjoy picnicking, hiking, and watching hang gliders launch from the overlook. The park is also a gateway to the larger Sproul State Forest, offering access to extensive outdoor recreation opportunities.

hang glidingpicnickingwildlife watchingphotographysightseeing+1 more
View park details

Ravensburg State Park

Clinton County, Pennsylvania, USA
18 miles away

"Lock Haven residents and students from Lock Haven University often visit Ravensburg State Park for its peaceful forests, birdwatching, and family-friendly recreation."

Ravensburg State Park, established in 1933, is one of Pennsylvania’s smaller state parks, offering a serene environment ideal for day-use recreation. The park is characterized by its deep ravine, lush vegetation, and the clear waters of Rauchtown Run. Facilities include picnic areas, rustic pavilions, and a small camping area. The park is named after the ravens that once nested in the cliffs above the gorge. Its peaceful atmosphere and natural features make it a hidden gem in the Pennsylvania state park system.

picnickingfishingbirdwatchingwildlife observationnature study+1 more
View park details

Hyner Run State Park

North Bend, Pennsylvania
20 miles away

"Lock Haven, a college town and the seat of Clinton County, offers dining, lodging, and supplies for visitors heading to Hyner Run State Park for hiking, fishing, and camping."

Hyner Run State Park serves as a gateway to backcountry adventure in the Pennsylvania Wilds region. While the park itself is small, it provides excellent camping facilities and connections to vast trail networks in surrounding state forests. The nearby Hyner View overlook offers spectacular scenery and is one of the premier hang gliding sites on the East Coast, making this area a destination for both ground-based and aerial outdoor enthusiasts.

CampingHikingBackpackingSwimmingWildlife Viewing+1 more
View park details

Susquehanna State Park

Williamsport, Lycoming County, Pennsylvania, USA
27 miles away

"Lock Haven, a college town and county seat, offers students and locals a nearby destination for picnicking, river cruises, and family outings in a natural setting."

Susquehanna State Park encompasses 20 acres along the West Branch Susquehanna River in Williamsport, Pennsylvania. The park is renowned for its riverboat, the Hiawatha Paddlewheel, which offers interpretive cruises. Visitors can enjoy fishing, boating, picnicking, and birdwatching in a peaceful natural environment. The park is open year-round and provides easy access to the river and nearby attractions in Williamsport.

boatingfishingpicnickingbirdwatchingriverboat tours+1 more
View park details

R.B. Winter State Park

Union County, Pennsylvania, USA
29 miles away

"Lock Haven, a college town along the Susquehanna River, provides easy access for residents and students seeking hiking, camping, and swimming at R.B. Winter State Park."

Nestled within the Bald Eagle State Forest, R.B. Winter State Park provides a tranquil retreat with its clear spring-fed lake, extensive picnic areas, and miles of hiking trails. The park is known for its natural beauty, abundant wildlife, and a wide range of recreational activities. Visitors can enjoy swimming, fishing, camping, and winter sports, all set against the backdrop of Pennsylvania’s scenic Ridge and Valley region.

HikingSwimmingFishingBoating (non-motorized)Camping+6 more
View park details
McCall's Dam State Park

By Carol M. Highsmith, Public domain

McCall's Dam State Park

Clinton County, Pennsylvania
30 miles away

"Lock Haven residents and visitors often head south into the nearby state forests, using McCall's Dam State Park as a tranquil spot to enjoy White Deer Creek and the surrounding mountain scenery."

McCall's Dam State Park is a tiny, forested day-use area in central Pennsylvania featuring shaded picnic sites and access to scenic White Deer Creek. It serves as a quiet roadside stop within Bald Eagle State Forest.

PicnickingFishingWildlife WatchingBirdwatchingNature Study+2 more
View park details

Poe Paddy State Park

Centre County, Pennsylvania, USA
32 miles away

"A river town with a college community, Lock Haven residents enjoy Poe Paddy State Park for its hiking and proximity to the Bald Eagle State Forest."

Poe Paddy State Park offers a peaceful retreat for outdoor enthusiasts, featuring rustic campsites, access to the scenic Penns Creek, and proximity to extensive forest lands. The park is a favorite destination for anglers, hikers, and campers seeking solitude and natural beauty. Its location along the Mid State Trail makes it a popular stop for backpackers, while the nearby Poe Paddy Tunnel adds a unique historical feature.

CampingFishingHikingWildlife viewingKayaking+4 more
View park details

Little Pine State Park

Lycoming County, Pennsylvania, USA
32 miles away

"Home to Lock Haven University, this college town provides a gateway for students and residents to experience the park's trails, wildlife, and tranquil lake."

Little Pine State Park encompasses over 2,000 acres of forested land in north-central Pennsylvania. The park is known for its picturesque lake, abundant recreational opportunities, and peaceful atmosphere. It serves as a gateway to the Pine Creek Gorge and offers year-round activities including swimming, ice fishing, and cross-country skiing.

campingfishingboatingswimminghiking+5 more
View park details

Upper Pine Bottom State Park

Cummings Township, Lycoming County, Pennsylvania, USA
32 miles away

"Home to Lock Haven University and a vibrant downtown, Lock Haven is a regional hub for outdoor enthusiasts exploring the Bald Eagle and Pine Creek regions."

Located in Lycoming County, Upper Pine Bottom State Park is one of Pennsylvania's smallest state parks, encompassing just 5 acres. It is situated at the confluence of Upper Pine Bottom Run and Little Pine Creek, offering a picturesque setting for outdoor enthusiasts. The park is unstaffed and primarily used for day-use activities, serving as a rest area for visitors to the surrounding Tiadaghton State Forest and Pine Creek Gorge.

PicnickingFishingWildlife viewingPhotographyNature observation
View park details

Kettle Creek State Park

Clinton County, Pennsylvania, USA
35 miles away

"Lock Haven, home to a university and a vibrant riverfront community, offers residents and students an easy day trip to Kettle Creek State Park for hiking, wildlife viewing, and outdoor recreation."

Located in the heart of the Pennsylvania Wilds, Kettle Creek State Park spans over 1,793 acres and is surrounded by the vast Sproul State Forest. The park’s centerpiece is the Kettle Creek Reservoir, which provides ample opportunities for water-based recreation. With modern and rustic camping options, scenic picnic areas, and miles of hiking trails, the park is a haven for nature lovers and outdoor enthusiasts. The remote setting makes it ideal for those seeking peace and solitude.

fishingboatingcanoeingkayakingcamping+7 more
View park details

Bucktail State Park Natural Area

Cameron and Clinton Counties, Pennsylvania, USA
38 miles away

"Lock Haven, a college town and home to Lock Haven University, offers easy access to Bucktail State Park for students and residents interested in nature, hiking, and scenic drives."

Established in 1933, Bucktail State Park Natural Area encompasses over 16 miles of pristine forests and waterways in Cameron and Clinton counties. The park is a designated natural area, preserving the wild character of the Sinnemahoning Creek valley. It offers visitors a chance to experience Pennsylvania's unspoiled wilderness, observe native wildlife, and enjoy the tranquility of the region.

wildlife viewingscenic drivingphotographybird watchingfishing+1 more
View park details

Black Moshannon State Park

Philipsburg, Pennsylvania
38 miles away

"Lock Haven, a college town along the West Branch Susquehanna River, provides outdoor enthusiasts and students with a nearby destination for hiking, kayaking, and wildlife observation."

Black Moshannon is renowned for its distinctive bog ecosystem and the dark, tea-colored lake that gives the park its name. The 1,992-acre protected bog natural area showcases rare plant species and unique wildlife. The park's trail system includes two boardwalk sections through the Moss-Hanne Trail, allowing visitors to experience the bog ecosystem up close without damage. The 41.5-mile Allegheny Front Trail encircles the park, offering exceptional backpacking opportunities.

HikingCampingSwimmingBoatingFishing+3 more
View park details

Poe Valley State Park

Centre County, Pennsylvania, USA
38 miles away

"Lock Haven residents appreciate Poe Valley State Park for its tranquil lake, forested trails, and as a nearby spot for outdoor recreation and family outings."

Located in Centre County, Poe Valley State Park encompasses 620 acres of forested land centered around the 25-acre Poe Lake. The park provides year-round recreational opportunities, including a modern campground, a sandy beach, picnic areas, and a boat launch. Surrounded by Bald Eagle State Forest, visitors can explore miles of trails and enjoy the natural beauty of the region. The park is a popular spot for fishing, swimming, boating (electric motors only), and wildlife observation.

campingfishingswimmingboatinghiking+4 more
View park details

Penn-Roosevelt State Park

Centre County, Pennsylvania, USA
38 miles away

"Lock Haven, a college town along the Susquehanna River, offers its residents and students an easy getaway to the park for outdoor adventures."

Penn-Roosevelt State Park provides a rustic outdoor experience in central Pennsylvania. The park features a small campground, a scenic picnic area, and a trout-stocked stream, all set within a remote section of Rothrock State Forest. Visitors can explore miles of nearby hiking and equestrian trails, observe wildlife, and enjoy the quiet beauty of the Seven Mountains region.

campingpicnickingfishinghikinghorseback riding+3 more
View park details

Sand Bridge State Park

Union County, Pennsylvania, USA
41 miles away

"Lock Haven, with its university and riverfront, offers residents a short drive to Sand Bridge State Park for nature escapes and family activities."

Sand Bridge State Park is one of Pennsylvania’s smallest state parks, covering just 3 acres. Located along Pennsylvania Route 192, the park is primarily used for picnicking and serves as a peaceful rest stop for travelers and outdoor enthusiasts. The park features shaded picnic tables, a small stream, and is surrounded by the larger Bald Eagle State Forest, providing access to hiking and wildlife viewing opportunities nearby.

PicnickingWildlife viewingPhotographyNature observation
View park details

Reeds Gap State Park

Milroy, Mifflin County, Pennsylvania, USA
41 miles away

"Lock Haven, a college town along the Susquehanna River, provides easy access for those looking to explore new hiking and picnic spots at Reeds Gap."

Located in Mifflin County, Reeds Gap State Park is a small but picturesque park that provides visitors with opportunities for picnicking, fishing, wildlife watching, and hiking. The park is surrounded by state forest land, making it a popular spot for those seeking a quiet retreat or a base for exploring the surrounding wilderness.

PicnickingFishingWildlife watchingHikingCross-country skiing+1 more
View park details

Shikellamy State Park

Sunbury, Pennsylvania
48 miles away

"A college town with Lock Haven University, this city offers residents and students a chance to experience the park's scenic overlooks and river access."

Two-section park offering both river recreation and spectacular views. The famous overlook sits 360 feet above the confluence of the Susquehanna's two branches, providing panoramic vistas of the river valley. The marina section offers boating and fishing access. Named for the Oneida diplomat who helped maintain peace in colonial Pennsylvania.

PicnickingBoatingFishingHikingScenic Views+2 more
View park details

World's End State Park

Forksville, Pennsylvania
54 miles away

"Lock Haven, a college town on the West Branch Susquehanna River, is a popular starting point for outdoor adventurers heading to the park’s scenic overlooks and trails."

A hidden gem in the endless mountains of north-central Pennsylvania, World's End lives up to its name with remote, rugged beauty. The park features stunning rock formations, pristine mountain streams, and some of the state's most challenging hiking.

HikingCampingFishingSwimmingRock Climbing+3 more
View park details

Ole Bull State Park

Ole Bull State Park, 31 Ole Bull Road, Cross Fork, PA 17729
54 miles away

"Home to Lock Haven University, this college town offers easy access to Ole Bull State Park for students and residents seeking hiking, camping, and outdoor adventure."

Located in the heart of Pennsylvania's northern wilderness, Ole Bull State Park provides a peaceful retreat for outdoor enthusiasts. The park features shaded campsites, a swimming area, and access to Kettle Creek for fishing and canoeing. Named after Norwegian violinist Ole Bull, who attempted to establish a colony in the area, the park preserves both natural beauty and cultural history. It is an ideal destination for families and nature lovers seeking relaxation and outdoor recreation.

campingfishinghikingswimmingwildlife watching+3 more
View park details

Ricketts Glen State Park

Benton, Pennsylvania
55 miles away

"This college town along the Susquehanna River offers residents easy access to Ricketts Glen for hiking, camping, and exploring waterfalls."

Known for its spectacular waterfalls and pristine wilderness, Ricketts Glen offers exceptional hiking opportunities through old-growth forest. The park's Falls Trail System showcases 24 named waterfalls, making it one of the most scenic natural areas in Pennsylvania.

HikingCampingSwimmingFishingBoating+2 more
View park details

Leonard Harrison State Park

Wellsboro, Pennsylvania
58 miles away

"A college town along the West Branch Susquehanna River, Lock Haven residents and students often visit the park for hiking, wildlife viewing, and outdoor adventure."

One of Pennsylvania's most scenic parks featuring stunning overlooks of the 800-foot deep Pine Creek Gorge. The challenging Turkey Path leads to waterfalls and the canyon floor. A must-visit for anyone exploring north-central Pennsylvania.

HikingScenic ViewsPhotographyWildlife ViewingPicnicking
View park details

Colton Point State Park

Wellsboro, Pennsylvania
58 miles away

"A college town along the West Branch Susquehanna River, Lock Haven offers visitors a mix of outdoor activities and serves as a gateway to north-central Pennsylvania attractions like Colton Point State Park."

The quieter counterpart to Leonard Harrison, offering equally stunning canyon views from the west rim. Features rustic CCC facilities, multiple overlooks, and a more secluded atmosphere for experiencing Pennsylvania's Grand Canyon.

HikingCampingScenic ViewsPhotographyWildlife Viewing
View park details

Lyman Run State Park

Potter County, Pennsylvania, USA
58 miles away

"Lock Haven, a small city along the West Branch Susquehanna River, offers visitors easy access to Lyman Run State Park for hiking, camping, and escaping into Pennsylvania's wild landscapes."

Lyman Run State Park encompasses 595 acres of picturesque forested land and is known for its clear mountain lake, abundant wildlife, and year-round recreational opportunities. The park offers modern and rustic camping, a sandy swimming beach, picnic areas, and access to hiking and snowmobiling trails. Its remote location provides a quiet, natural setting ideal for relaxation and outdoor adventure.

campingfishingboatingswimminghiking+5 more
View park details

Cherry Springs State Park

Coudersport, Pennsylvania
58 miles away

"Lock Haven, home to a university and set along the Susquehanna River, attracts outdoor enthusiasts who may venture to Cherry Springs State Park for its exceptional stargazing and tranquil forest setting."

Pennsylvania's premier destination for stargazing, with some of the darkest skies on the East Coast. The park's high elevation and remote location create perfect conditions for viewing the Milky Way, planets, and deep space objects.

StargazingAstronomyHikingWildlife ViewingPhotography
View park details

Sinnemahoning State Park

Austin, Pennsylvania
59 miles away

"Lock Haven, a college town home to Commonwealth University–Lock Haven, is within easy driving distance for students and locals looking for hiking and nature activities at Sinnemahoning."

Sinnemahoning State Park is renowned as one of Pennsylvania's premier elk viewing destinations. The park is managed cooperatively between DCNR's Bureau of State Parks and the Pennsylvania Game Commission to optimize wildlife habitat and viewing opportunities. The grassy opening near the viewing platform is specifically planted with clover and trefoil to attract elk and other wildlife. The park's remote location and extensive surrounding state forest create excellent habitat for Pennsylvania's largest land mammal.

Elk ViewingWildlife WatchingHikingBikingCamping+3 more
View park details