Picnicking Parks Near Lock Haven

Discover 19 parks for picnicking within driving distance of Lock Haven

Bald Eagle State Park

149 Main Park Road, Howard, PA 16841, Centre County, Pennsylvania, USA
15 miles away

"A nearby college town and county seat, Lock Haven residents enjoy quick access to Bald Eagle State Park for outdoor recreation, fishing, and family outings."

A 5,900-acre park in Centre County, PA, featuring a large reservoir, diverse habitats, and year-round recreation.

boatingfishingswimminghikingbirdwatching+8 more
View park details

Hyner View State Park

Clinton County, Pennsylvania, USA
16 miles away

"Lock Haven, home to Lock Haven University, offers amenities and lodging for travelers and is a popular starting point for exploring the natural beauty of Clinton County."

Scenic overlook park known for hang gliding, picnicking, and sweeping views of the West Branch Susquehanna River.

hang glidingpicnickingwildlife watchingphotographysightseeing+1 more
View park details

Ravensburg State Park

Clinton County, Pennsylvania, USA
18 miles away

"Lock Haven residents and students from Lock Haven University often visit Ravensburg State Park for its peaceful forests, birdwatching, and family-friendly recreation."

A tranquil 78-acre park in Clinton County, PA, featuring mature forests, a scenic gorge, and opportunities for picnicking, fishing, and wildlife viewing.

picnickingfishingbirdwatchingwildlife observationnature study+1 more
View park details

Susquehanna State Park

Williamsport, Lycoming County, Pennsylvania, USA
27 miles away

"Lock Haven, a college town and county seat, offers students and locals a nearby destination for picnicking, river cruises, and family outings in a natural setting."

A riverside park in Lycoming County known for boating, fishing, and scenic views along the Susquehanna River.

boatingfishingpicnickingbirdwatchingriverboat tours+1 more
View park details
McCall's Dam State Park

By Carol M. Highsmith, Public domain

McCall's Dam State Park

Clinton County, Pennsylvania
30 miles away

"Lock Haven residents and visitors often head south into the nearby state forests, using McCall's Dam State Park as a tranquil spot to enjoy White Deer Creek and the surrounding mountain scenery."

A small, secluded day-use park along White Deer Creek offering quiet picnicking and creekside relaxation in Bald Eagle State Forest.

PicnickingFishingWildlife WatchingBirdwatchingNature Study+2 more
View park details

Upper Pine Bottom State Park

Cummings Township, Lycoming County, Pennsylvania, USA
32 miles away

"Home to Lock Haven University and a vibrant downtown, Lock Haven is a regional hub for outdoor enthusiasts exploring the Bald Eagle and Pine Creek regions."

A quiet, forested state park in north-central Pennsylvania, ideal for picnicking and enjoying the natural beauty of Pine Creek Gorge.

PicnickingFishingWildlife viewingPhotographyNature observation
View park details

Little Pine State Park

Lycoming County, Pennsylvania, USA
32 miles away

"Home to Lock Haven University, this college town provides a gateway for students and residents to experience the park's trails, wildlife, and tranquil lake."

A scenic state park in Lycoming County, PA, featuring a 94-acre lake, camping, fishing, and hiking in the heart of the Pennsylvania Wilds.

campingfishingboatingswimminghiking+5 more
View park details

Kettle Creek State Park

Clinton County, Pennsylvania, USA
35 miles away

"Lock Haven, home to a university and a vibrant riverfront community, offers residents and students an easy day trip to Kettle Creek State Park for hiking, wildlife viewing, and outdoor recreation."

A serene park in Clinton County, PA, offering fishing, boating, camping, and wildlife viewing around a picturesque reservoir.

fishingboatingcanoeingkayakingcamping+7 more
View park details

Bucktail State Park Natural Area

Cameron and Clinton Counties, Pennsylvania, USA
38 miles away

"Lock Haven, a college town and home to Lock Haven University, offers easy access to Bucktail State Park for students and residents interested in nature, hiking, and scenic drives."

A picturesque natural area along PA Route 120, known for wildlife viewing, scenic vistas, and rich Civil War history.

wildlife viewingscenic drivingphotographybird watchingfishing+1 more
View park details

Ole Bull State Park

Ole Bull State Park, 31 Ole Bull Road, Cross Fork, PA 17729
54 miles away

"Home to Lock Haven University, this college town offers easy access to Ole Bull State Park for students and residents seeking hiking, camping, and outdoor adventure."

A tranquil 132-acre park in Potter County, PA, offering camping, fishing, hiking, and picnicking in a scenic forested valley.

campingfishinghikingswimmingwildlife watching+3 more
View park details

Lyman Run State Park

Potter County, Pennsylvania, USA
58 miles away

"Lock Haven, a small city along the West Branch Susquehanna River, offers visitors easy access to Lyman Run State Park for hiking, camping, and escaping into Pennsylvania's wild landscapes."

A tranquil state park in Potter County featuring a 45-acre lake, camping, fishing, and forested recreation in the Pennsylvania Wilds.

campingfishingboatingswimminghiking+5 more
View park details