Wildlife Watching Parks Near State College

Discover 18 parks for wildlife watching within driving distance of State College

Whipple Dam State Park

Huntingdon County, Pennsylvania, USA
12 miles away

"Home to Penn State University, State College residents and students often visit Whipple Dam State Park for outdoor recreation, swimming, and hiking in a scenic natural setting."

A serene park in central Pennsylvania featuring a lake, historic beach house, and forested recreation areas.

SwimmingBoating (non-motorized)FishingPicnickingWildlife watching+5 more
View park details

Penn-Roosevelt State Park

Centre County, Pennsylvania, USA
18 miles away

"Home to Penn State University, State College residents and students often seek outdoor recreation and hiking opportunities at Penn-Roosevelt State Park, just a short drive away."

A secluded, forested state park offering rustic camping, hiking, and trout fishing in the heart of Rothrock State Forest.

campingpicnickingfishinghikinghorseback riding+3 more
View park details

Greenwood Furnace State Park

15795 Greenwood Road, Huntingdon, PA 16652
28 miles away

"Home to Penn State University, State College residents and students often escape to Greenwood Furnace for camping, swimming, and exploring nature away from campus life."

A historic park in Huntingdon County featuring a restored iron furnace, a picturesque lake, and year-round outdoor recreation.

hikingswimmingfishingboatingwildlife watching+6 more
View park details

Reeds Gap State Park

Milroy, Mifflin County, Pennsylvania, USA
28 miles away

"Home to Penn State University, State College residents and students often visit the park for hiking, camping, and a peaceful retreat from campus life."

A peaceful 220-acre park in Mifflin County, PA, offering picnicking, fishing, and access to Bald Eagle State Forest.

PicnickingFishingWildlife watchingHikingCross-country skiing+1 more
View park details

Poe Valley State Park

Centre County, Pennsylvania, USA
32 miles away

"Home to Penn State University, State College offers a large population of students and families who enjoy the park's hiking, swimming, and natural beauty as a quick getaway from campus life."

A serene state park in central Pennsylvania featuring Poe Lake, camping, fishing, and access to Bald Eagle State Forest.

campingfishingswimmingboatinghiking+4 more
View park details

R.B. Winter State Park

Union County, Pennsylvania, USA
38 miles away

"As the home of Penn State University, State College is a major population center whose residents and students visit R.B. Winter State Park for outdoor activities and a break from campus life."

A 695-acre park in central Pennsylvania featuring Halfway Lake, forested ridges, and year-round outdoor recreation.

HikingSwimmingFishingBoating (non-motorized)Camping+6 more
View park details
McCall's Dam State Park

By Carol M. Highsmith, Public domain

McCall's Dam State Park

Clinton County, Pennsylvania
45 miles away

"Home to Penn State University, State College residents visit McCall's Dam State Park for a quiet forest picnic, cool creekside relaxation, and a peaceful alternative to busier regional parks."

A small, secluded day-use park along White Deer Creek offering quiet picnicking and creekside relaxation in Bald Eagle State Forest.

PicnickingFishingWildlife WatchingBirdwatchingNature Study+2 more
View park details

S.B. Elliott State Park

Clearfield County, Pennsylvania, USA
54 miles away

"Home to Penn State University, State College is a vibrant college town whose students and families visit the park for camping, hiking, and group outings."

A historic, forested park in Clearfield County, PA, offering camping, picnicking, and access to the Moshannon State Forest.

campingpicnickinghikingwildlife watchingbirding+3 more
View park details

Hyner View State Park

Clinton County, Pennsylvania, USA
54 miles away

"State College, home to Penn State University, is a vibrant college town with a large population and serves as a hub for outdoor enthusiasts looking to explore the nearby state parks."

Scenic overlook park known for hang gliding, picnicking, and sweeping views of the West Branch Susquehanna River.

hang glidingpicnickingwildlife watchingphotographysightseeing+1 more
View park details

Parker Dam State Park

Penfield, Pennsylvania
55 miles away

"State College residents and Penn State students use Parker Dam State Park as a quieter alternative to busier parks, with opportunities for camping, hiking, and winter sports within a reasonable drive."

Parker Dam State Park is a forested Pennsylvania state park with a scenic lake, historic CCC structures, and year-round outdoor recreation.

HikingSwimmingFishingBoatingKayaking+12 more
View park details

Milton State Park

Milton, Pennsylvania
55 miles away

"State College visitors looking for a quieter river setting beyond the mountains may travel to Milton State Park for day-use recreation and to explore small river towns along the Susquehanna."

Milton State Park is a Susquehanna River island park offering day-use recreation, river access, and natural habitats near Milton, Pennsylvania.

FishingBoatingKayakingCanoeingWildlife Watching+7 more
View park details

Fowlers Hollow State Park

Perry County, Pennsylvania, USA
57 miles away

"Home to Penn State University, State College is a major college town whose students and outdoor enthusiasts visit Fowlers Hollow for hiking and camping in a less crowded setting."

A quiet, 104-acre park in Perry County, PA, offering camping, picnicking, and easy access to hiking in Tuscarora State Forest.

CampingPicnickingHikingFishingWildlife watching+2 more
View park details

Little Pine State Park

Lycoming County, Pennsylvania, USA
57 miles away

"Home to Penn State University, State College residents and students often visit the park for outdoor adventures, camping, and a change of scenery from campus life."

A scenic state park in Lycoming County, PA, featuring a 94-acre lake, camping, fishing, and hiking in the heart of the Pennsylvania Wilds.

campingfishingboatingswimminghiking+5 more
View park details

Big Spring State Park

Perry County, Pennsylvania, USA
58 miles away

"Home to Penn State University, State College is a popular college town where students and faculty enjoy weekend trips to Big Spring State Park for hiking and relaxation."

A tranquil day-use park in Perry County, PA, featuring historic sites, picnic areas, and scenic mountain views.

PicnickingWildlife watchingPhotographyHistoric site explorationNature study
View park details

Shikellamy State Park

Sunbury, Pennsylvania
60 miles away

"Home to Penn State University, State College is a major college town where students and families often travel to Shikellamy State Park for hiking, sightseeing, and picnics."

Dramatic river overlook 360 feet above Susquehanna River confluence with historic significance.

PicnickingBoatingFishingHikingScenic Views+2 more
View park details

Colonel Denning State Park

Newville, Pennsylvania
60 miles away

"State College, home to Penn State University, offers students and residents a scenic getaway at Colonel Denning State Park for hiking, camping, and group outings."

Mountain valley park in Doubling Gap with Tuscarora Trail access and Flat Rock overlook.

HikingCampingFishingPicnickingWildlife Watching+1 more
View park details

Kettle Creek State Park

Clinton County, Pennsylvania, USA
60 miles away

"State College, home to Penn State University, offers students and locals a chance to escape to the natural beauty and tranquility of Kettle Creek State Park for outdoor adventure and relaxation."

A serene park in Clinton County, PA, offering fishing, boating, camping, and wildlife viewing around a picturesque reservoir.

fishingboatingcanoeingkayakingcamping+7 more
View park details