New York State Parks Near Kingston

Discover 23 parks within driving distance of Kingston

Sojourner Truth State Park

By Victoria Stauffenberg, Public domain

Sojourner Truth State Park

Kingston, New York
2 miles away

"Kingston is a vibrant city with historic districts, arts, and dining, making it an ideal base for park visitors seeking culture and amenities."

Sojourner Truth State Park features forested trails, riverfront access, and interpretive areas celebrating the life of Sojourner Truth. It’s ideal for hiking, birdwatching, and enjoying the Hudson Valley’s natural beauty.

HikingBirdwatchingPicnickingPhotographyNature Study
View park details

Frances Slocum State Park

Luzerne County, Pennsylvania, USA
8 miles away

"Kingston locals appreciate the park’s proximity for outdoor recreation, making it a popular spot for weekend outings and group gatherings."

Nestled in the Wyoming Valley, Frances Slocum State Park is a haven for outdoor recreation and relaxation. The park’s centerpiece is Frances Slocum Lake, ideal for boating and fishing, surrounded by forests and meadows that provide habitat for abundant wildlife. Visitors can enjoy camping, hiking, swimming, and winter activities such as cross-country skiing and ice skating. The park also offers modern amenities, picnic areas, and educational programs.

boatingfishingswimminghikingcamping+8 more
View park details

Nescopeck State Park

Drums, Pennsylvania
17 miles away

"Residents of Kingston can take advantage of the park's proximity for weekend hikes, nature walks, and seasonal events."

Nescopeck State Park prioritizes conservation of its unique natural resources while offering quality outdoor recreation. The prohibition on mountain biking reflects commitment to protecting sensitive habitats. The extensive trail system allows visitors to explore varied ecosystems from wetlands to mature forests, making this an excellent destination for nature study and wildlife observation.

HikingWildlife ViewingBird WatchingCross-Country SkiingSnowshoeing+1 more
View park details

Margaret Lewis Norrie State Park

Staatsburg, New York
18 miles away

"Kingston visitors appreciate the park's natural beauty and proximity to the Hudson River, perfect for day trips and outdoor activities."

Located on the eastern shore of the Hudson River, Margaret Lewis Norrie State Park features wooded campsites, boat launches, and picnic areas. The park is ideal for fishing, birdwatching, and enjoying riverfront scenery.

CampingFishingBoatingPicnickingBirdwatching+2 more
View park details

Franny Reese State Park

Highland, New York
20 miles away

"Kingston locals appreciate the park's historic features and natural beauty, making it a popular day-trip destination for families and outdoor enthusiasts."

Franny Reese State Park features over 250 acres of forested hills, historic stone walls, and panoramic vistas of the Hudson River. Visitors enjoy hiking, birdwatching, and exploring the park's tranquil natural beauty.

HikingBirdwatchingPhotographySnowshoeingNature Study
View park details

Minnewaska State Park Preserve

Kerhonkson, New York
23 miles away

"Historic Kingston offers museums, waterfront dining, and easy access to the Hudson Valley, drawing visitors seeking culture and outdoor adventure."

Minnewaska State Park Preserve features rugged terrain, waterfalls, and crystal-clear lakes, making it a favorite destination for hiking, biking, and swimming. Its panoramic vistas and diverse ecosystems attract visitors throughout the year.

HikingSwimmingBikingRock ClimbingPicnicking+3 more
View park details

Archbald Pothole State Park

Archbald, Pennsylvania, Lackawanna County
27 miles away

"Kingston residents often travel to the park for its accessible trails and to experience one of Pennsylvania’s most fascinating natural landmarks."

Located in Lackawanna County, Archbald Pothole State Park preserves a remarkable geological feature formed during the last ice age. The park’s centerpiece, the Archbald Pothole, measures 38 feet deep and 42 feet wide at its largest point. The area offers a peaceful setting for picnics and short walks, with interpretive panels explaining the pothole’s significance.

SightseeingPicnickingPhotographyNature studyEducational programs
View park details

Hickory Run State Park

White Haven, Pennsylvania
27 miles away

"Kingston, part of the greater Wilkes-Barre area, provides easy access for families and outdoor lovers to enjoy the park’s amenities."

Hickory Run State Park combines unique geological features with extensive recreational opportunities in the Pocono Mountains. The Boulder Field, accessible by hiking trail or car, offers a rare chance to walk across acres of ancient boulders. The park's trail system ranges from easy nature walks to challenging backcountry routes, showcasing waterfalls, rhododendron tunnels, and pristine streams.

HikingCampingSwimmingFishingWildlife Viewing+2 more
View park details

Lackawanna State Park

Dalton, Pennsylvania
27 miles away

"Kingston families and outdoor enthusiasts visit the park for its peaceful lake, picnic spots, and extensive network of hiking and biking trails."

Lackawanna State Park provides quality outdoor recreation within minutes of Scranton's urban core. The extensive trail system offers something for everyone from casual walkers to serious mountain bikers. The 198-acre lake serves as the centerpiece for water-based activities. The park's heavy use reflects its importance as an accessible natural retreat for northeastern Pennsylvania's population.

HikingMountain BikingHorseback RidingCampingSwimming+3 more
View park details

Lehigh Gorge State Park

White Haven, Pennsylvania
27 miles away

"Kingston, adjacent to Wilkes-Barre, offers residents quick access to Lehigh Gorge State Park for hiking, biking, and picnicking in a scenic natural setting."

A dramatic river gorge protecting over 20 miles of the Lehigh River. The 26-mile Lehigh Gorge Trail rail trail provides spectacular access for biking and hiking. World-class whitewater boating during dam releases. Part of the 165-mile Delaware and Lehigh National Heritage Corridor.

HikingBikingWhitewater BoatingKayakingFishing+3 more
View park details

Mary Island State Park

Alexandria Bay, New York
28 miles away

"Kingston, Ontario, offers a vibrant waterfront and historic sites. Canadian visitors often cross the border to explore the unique islands and natural beauty of the St. Lawrence River."

Nestled on the St. Lawrence River, Mary Island State Park is a peaceful retreat accessible only by watercraft. The park features campsites, picnic areas, and prime fishing and boating opportunities.

BoatingFishingCampingPicnickingBird Watching
View park details

James Baird State Park

Pleasant Valley, New York
29 miles away

"Kingston visitors appreciate the park's open spaces and sports facilities, making it a great day-trip destination for picnics and group activities."

James Baird State Park boasts an 18-hole golf course, sports facilities, and tranquil woodlands for walking and picnicking. Its open spaces and amenities make it a popular destination for families and groups.

GolfingPicnickingWalkingBikingBird Watching+2 more
View park details

Galop Island State Park

Wellesley Island, New York
30 miles away

"Visitors from Kingston, Ontario, can cross the border for a unique island experience, enjoying the natural beauty and recreational opportunities of the St. Lawrence River."

Galop Island State Park is a tranquil, boat-accessible destination in the Thousand Islands region. It features wooded areas, shoreline access, and prime fishing spots, making it ideal for a quiet day trip or picnic.

FishingBoatingPicnickingBird WatchingWildlife Viewing
View park details

Vosburg Neck State Park

Tunkhannock, Pennsylvania
33 miles away

"Kingston visitors often pair a trip to Vosburg Neck State Park with scenic drives along the Susquehanna, taking advantage of the park’s open spaces and river views for relaxed day outings."

Located along the North Branch of the Susquehanna River, Vosburg Neck State Park features forested slopes, open fields, and striking river vistas in rural northeastern Pennsylvania. The park offers day-use recreation, wildlife viewing, and access to the river in a tranquil setting.

HikingFishingBoatingKayakingCanoeing+7 more
View park details

Wellesley Island State Park

Wellesley Island, New York
35 miles away

"Kingston, Ontario, is a historic Canadian city just across the border, known for its waterfront, museums, and vibrant downtown. Many visitors cross the border to experience the natural beauty of Wellesley Island."

Wellesley Island State Park features one of the largest campgrounds in New York, a sandy swimming beach, marina, and nature center. Its location in the Thousand Islands region provides excellent opportunities for boating, fishing, and wildlife observation.

CampingBoatingFishingSwimmingHiking+5 more
View park details

Lake Taghkanic State Park

Ancram, New York
36 miles away

"Kingston, with its historic waterfront and vibrant arts community, is a convenient city for visitors planning a trip to Lake Taghkanic."

Lake Taghkanic State Park is known for its clear lake, sandy beach, and extensive outdoor activities including swimming, boating, hiking, and winter sports. The park also offers cabins, campsites, and picnic facilities.

SwimmingBoatingFishingHikingPicnicking+5 more
View park details

Hudson River Islands State Park

Coxsackie, New York
39 miles away

"Kingston, rich in history and culture, is a popular starting point for Hudson River adventures. Residents appreciate the park’s secluded camping and river access."

Hudson River Islands State Park features primitive campsites, fishing, and wildlife viewing on two picturesque islands in the Hudson River. Accessible only by boat, it provides a serene retreat for nature lovers.

CampingFishingBirdwatchingBoatingPicnicking+2 more
View park details

Taconic State Park

Copake Falls, New York
52 miles away

"Kingston, a historic Hudson Valley city, offers arts and dining. Residents often head to Taconic State Park for hiking and family-friendly recreation."

Taconic State Park features rugged mountains, cascading waterfalls, and a variety of outdoor recreation opportunities. Its location along the Taconic Ridge makes it a prime destination for hiking, camping, and exploring nature.

HikingSwimmingFishingCampingCross-Country Skiing+4 more
View park details

Westcott Beach State Park

Henderson, New York
52 miles away

"Kingston, Ontario, visitors cross the border to enjoy Westcott Beach’s natural beauty and recreational amenities along Lake Ontario’s southern shore."

Westcott Beach State Park boasts sandy beaches, wooded campsites, and panoramic views of Lake Ontario. Visitors enjoy swimming, boating, fishing, and picnicking in a picturesque setting.

SwimmingFishingBoatingCampingPicnicking+4 more
View park details

Thompson’s Lake State Park

East Berne, New York
55 miles away

"Kingston visitors enjoy the park’s lakeside amenities and proximity to the Helderberg Escarpment, perfect for weekend getaways."

Thompson’s Lake State Park features a picturesque lake, wooded campsites, and direct access to hiking trails. Visitors enjoy swimming, boating, fishing, and winter activities in a serene mountain setting.

SwimmingFishingBoatingCampingPicnicking+4 more
View park details
Schodack Island State Park

By Spc. Andrew Valenza, Public domain

Schodack Island State Park

Castleton-on-Hudson, New York
56 miles away

"Kingston, with its rich history and riverfront attractions, is within an hour’s drive, making Schodack Island a great spot for weekend adventures."

Schodack Island State Park boasts over 1,000 acres of forests, wetlands, and shoreline along the Hudson River. Visitors enjoy hiking, biking, birdwatching, and water-based recreation in a tranquil, natural setting.

HikingBikingFishingBoatingBirdwatching+4 more
View park details

Mine Kill State Park

North Blenheim, New York
58 miles away

"Kingston residents seeking outdoor recreation and scenic drives find Mine Kill State Park an ideal destination for hiking and picnicking."

Mine Kill State Park is renowned for its dramatic waterfalls, Olympic-sized swimming pool, and miles of multi-use trails. Visitors enjoy fishing, boating, and picnicking amid beautiful valley views.

HikingSwimmingFishingBoatingPicnicking+4 more
View park details

Lake Superior State Park

Bethel, New York
59 miles away

"Kingston, known for its vibrant arts scene and historic districts, is a popular destination for those seeking a mix of culture and nature."

Lake Superior State Park features a large lake, sandy beach, picnic areas, and opportunities for swimming, boating, fishing, and hunting. Its peaceful setting makes it ideal for family outings and nature lovers.

SwimmingFishingBoatingPicnickingHunting+1 more
View park details