All state parks Logo

Swimming Parks Near Galeton

Discover 2 parks for swimming within driving distance of Galeton

Lyman Run State Park

Public Domain

Lyman Run State Park

Potter County, Pennsylvania, USA
8 miles away

"Galeton is the closest town to Lyman Run State Park, making it a convenient base for visitors seeking outdoor recreation, camping, and hiking in the park."

A tranquil state park in Potter County featuring a 45-acre lake, camping, fishing, and forested recreation in the Pennsylvania Wilds.

campingfishingboatingswimminghiking+5 more
View park details
Ole Bull State Park

Public Domain

Ole Bull State Park

Ole Bull State Park, 31 Ole Bull Road, Cross Fork, PA 17729
28 miles away

"Galeton is a small town known for its proximity to the Pennsylvania Wilds, making Ole Bull State Park a popular destination for outdoor recreation and nature getaways."

A tranquil 132-acre park in Potter County, PA, offering camping, fishing, hiking, and picnicking in a scenic forested valley.

campingfishinghikingswimmingwildlife watching+3 more
View park details
Quick Links
All State Parks
POPULAR ACTIVITIES
campingfishingswimminghikingwildlife watchingcross-country skiing
PARKS NEAR OTHER CITIES
PittsburghPhiladelphiaHarrisburg