Snowmobiling Parks Near Bradford

Discover 3 parks for snowmobiling within driving distance of Bradford

By Clint - originally posted to Flickr as Sizerville State Park - HDR, CC BY-SA 2.0

Sizerville State Park

Cameron and Potter counties, Pennsylvania, USA

38 miles away

"Bradford, home to the University of Pittsburgh at Bradford and the Zippo/Case Museum, offers residents and students easy access to Sizerville State Park for hiking, camping, and outdoor education."

A peaceful 386-acre park in Cameron and Potter counties, surrounded by Elk State Forest, known for its camping, fishing, hiking, and family-friendly amenities.

campingfishinghikingswimmingpicnicking+5 more

View park details

Public Domain

Lyman Run State Park

Potter County, Pennsylvania, USA

48 miles away

"Bradford, a city known for its oil history and the Zippo/Case Museum, is within easy driving distance for residents seeking outdoor recreation at Lyman Run State Park."

A tranquil state park in Potter County featuring a 45-acre lake, camping, fishing, and forested recreation in the Pennsylvania Wilds.

campingfishingboatingswimminghiking+5 more

View park details

By User:Ruhrfisch - Photographed it myself, CC BY-SA 3.0

Patterson State Park

Potter County, Pennsylvania, USA

48 miles away

"Bradford, a city with over 8,000 residents and home to the Zippo/Case Museum, offers easy access to Patterson State Park for those seeking hiking and camping in the Pennsylvania Wilds."

A quiet, forested state park in Potter County, PA, ideal for picnicking, hiking, and access to snowmobile trails.

PicnickingHikingSnowmobilingWildlife watching

View park details

Quick Links

All State Parks

POPULAR ACTIVITIES

camping fishing hiking swimming picnicking wildlife watching

PARKS NEAR OTHER CITIES

Pittsburgh Philadelphia Harrisburg